PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g088070.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 463aa    MW: 51224.9 Da    PI: 6.3908
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g088070.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.21.8e-38106165261
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         +ek+l+cprC+s++tkfCy+nny+ sqPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  Sopim02g088070.0.1 106 PEKTLPCPRCNSMETKFCYFNNYNASQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKHKNS 165
                         78999***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-27103163IPR003851Zinc finger, Dof-type
PfamPF027012.5E-31108164IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.379110164IPR003851Zinc finger, Dof-type
PROSITE patternPS013610112148IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MSEAIAIKDP AIKLFGWTIQ LPDFPAPAPE DSSFLAGEVE QELKGLYDDC IDDNEHLTTE  60
DSQDQNPIQQ RCDIINYYES STAKTSKSKE EHGETSNSHE RNLKKPEKTL PCPRCNSMET  120
KFCYFNNYNA SQPRHFCKNC QRYWTAGGTM RNVPVGAGRR KHKNSVLHYS HVSVSEALSN  180
VRTNFPTETQ HPPLTLNGTI LSFDTDKPVS ESMVSVLNVA DKGMQNCSGN GFQKYKELRI  240
QAGDNGDDHS DGSSVTAISS KDSDNGLPNT PRKNYNSFPT HLPCFTGAPW PYIWSSVHCR  300
NAVPPPGYSL PGIPMSFIPA TTYWGCTIPG SWNVPWMSPP TASHNQMPLT PDPNSPTSRK  360
HSRDENVLKS TGTEEEQRKE SDPGKRLWFP KTLRIDDPGE AAKSPIWATL GIKHEVVNSV  420
GGGLLSDFLP KNDERSCVSE NSTLLQVNPA AMSRSLNFNE SS*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2327690.0AC232769.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0054K23, complete sequence.
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232217.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLK4BBW30.0K4BBW3_SOLLC; Uncharacterized protein
STRINGSolyc02g088070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-82cycling DOF factor 2